NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104988_10767

Scaffold Ga0104988_10767


Overview

Basic Information
Taxon OID3300007735 Open in IMG/M
Scaffold IDGa0104988_10767 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)27278
Total Scaffold Genes43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (41.86%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameGangwon-do, South Korea
CoordinatesLat. (o)37.953056Long. (o)127.81721Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000345Metagenome / Metatranscriptome1253Y
F055547Metagenome / Metatranscriptome138Y
F072274Metagenome / Metatranscriptome121Y
F099175Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0104988_1076723F099175N/ALIGGLMVQNIEETIKKEHVEDLKDFATYLGVDFEDYLEFLHPDVDFDDYSR*
Ga0104988_1076724F072274N/AMTTPDKTEENGIDGYISPNRMWAAVPWGEGKYISIYNGEQICVHHSLETAKKFIQKETRKRK*
Ga0104988_1076731F055547AGGMIGTNWFQKKWGLDDPMLIDELYDRIVHLEQRVKVLEEENINTTNSLYEIANSLEARIDILASEPYNLNKGRK*
Ga0104988_1076736F000345N/AMEEKQPNEFGKALQEWWDSDACKNLQQANEEARQRAVGKYFMLSEEDKIDMVEAITHIMCKAEREGCSHRGLQSALGIYPGGFWVNHLMDVHNSLWSYYHDKKQKEELEKDIKTLQDFTET*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.