Scaffold Ga0105664_1092232

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105664_1092232

Scaffold Ga0105664_1092232

Overview

Basic Information
Taxon OID	3300007756 Open in IMG/M
Scaffold ID	Ga0105664_1092232 Open in IMG/M
Source Dataset Name	Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	866
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location Name	Northeast Pacific Ocean
Coordinates	Lat. (^o)	45.9372	Long. (^o)	-130.082	Alt. (m)		Depth (m)	1500
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090256	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105664_10922322	F090256	AGGAGG	VQSNTSTETSTLKVGDLGEQLVAEHFKHAERTDDWFDSKKDGTIKEKTYEVKTFRLNNKDQGFWVDSSQFRKLDNVDILYFVKIPESLEEGATIYECMDHTSEDAYESFKLGPIKQMRCYFLDNCKKITNIRDERTDALYHNSVAMSKWKRFN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.