NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105108_101059

Scaffold Ga0105108_101059


Overview

Basic Information
Taxon OID3300007813 Open in IMG/M
Scaffold IDGa0105108_101059 Open in IMG/M
Source Dataset NameExtremophilic microbial mat communities from Yellowstone National Park, USA - BED_Mat_virus_6_15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1254
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, USA
CoordinatesLat. (o)44.7315Long. (o)-110.7113Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062912Metagenome / Metatranscriptome130Y
F077497Metagenome / Metatranscriptome117Y
F087443Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0105108_1010592F062912N/AMDSQTVLAETYNLFLVSDIIENESDIDKELEGLLADRDYNNMAKTLMYTLIYTINNDPAYRNIRQIYINEAIDLLYMIDRVGFDNEKIMKKFINFLYQFYSYSLQYKINFIADKEKREFVKAELNELYMLIEE*
Ga0105108_1010593F087443N/AMGQRKNYWMNFLDSDNVDYIDKEITKTAVDLDLDPSEIRAWIFKAFIYDMEVKAKVIEYIKKNGQGTNQ*
Ga0105108_1010594F077497N/AMDKEQISKIEEIIEKHLFEETNNSTYELNKIYAITQYLIYQQLKNINEKLDSIDQDLYELANPGIYEK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.