Basic Information | |
---|---|
Taxon OID | 3300007814 Open in IMG/M |
Scaffold ID | Ga0105117_1027690 Open in IMG/M |
Source Dataset Name | Extremophilic microbial mat communities from Yellowstone National Park, USA - OSPB_Slides-mat_host_7_15 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 663 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, USA | |||||||
Coordinates | Lat. (o) | 44.733 | Long. (o) | -110.709 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087443 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105117_10276902 | F087443 | N/A | MGQRKNYWMTFLDSDNVDYIDKEITKTAVDLDLDPSEIRAWIFKAFIYDMEVKAKIIEYIKKNGQGTNQ* |
⦗Top⦘ |