NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104323_108228

Scaffold Ga0104323_108228


Overview

Basic Information
Taxon OID3300007821 Open in IMG/M
Scaffold IDGa0104323_108228 Open in IMG/M
Source Dataset NamePermafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPrinceton University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1144
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway

Source Dataset Sampling Location
Location Namesvalbard,norway
CoordinatesLat. (o)78.11096Long. (o)15.55294Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034366Metagenome175Y

Sequences

Protein IDFamilyRBSSequence
Ga0104323_1082281F034366N/AMAKGGITTMGVGNIVALVCIIISVVFAVITHQATNAVWWALLAIFAVLWWDARAPWGRP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.