Scaffold Ga0104323_132103

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104323_132103

Scaffold Ga0104323_132103

Overview

Basic Information
Taxon OID	3300007821 Open in IMG/M
Scaffold ID	Ga0104323_132103 Open in IMG/M
Source Dataset Name	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Princeton University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10710
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (72.73%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway

Source Dataset Sampling Location
Location Name	svalbard,norway
Coordinates	Lat. (^o)	78.11096	Long. (^o)	15.55294	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001435	Metagenome / Metatranscriptome	695	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104323_13210311	F001435	GGCGG	MPGRGRDAPRRVERKLYSVDSVVDRGFEDVEEEAGSRRVHWTIVKRTTADQISRKPVSALYVVQRDGVDSEFPNLGAARGAVNKTIVHPEKLTRSKAEYAAEKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.