NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111032_1048407

Scaffold Ga0111032_1048407


Overview

Basic Information
Taxon OID3300007871 Open in IMG/M
Scaffold IDGa0111032_1048407 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf. Combined Assembly of MM2PM2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAarhus University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2441
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location
Location NameAarhus Bay station M5
CoordinatesLat. (o)56.10555Long. (o)10.463333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051941Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0111032_10484072F051941N/AMATSFKNMIYDLTPTTSEQTVYGIPTDSHSIINAFYVNNTGGSTINIEVRLDRGPGRNYVASKTIVFSTPLTSGQYLNLLTGPLVLEGGDKLVFTTNTTGRVQGTIAAMQVNREDQETTPIGSV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.