NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111544_1009220

Scaffold Ga0111544_1009220


Overview

Basic Information
Taxon OID3300007917 Open in IMG/M
Scaffold IDGa0111544_1009220 Open in IMG/M
Source Dataset NameMicrobial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Liverpool
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1554
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment

Source Dataset Sampling Location
Location NameUnited Kingdom
CoordinatesLat. (o)54.9632021Long. (o)-1.6348029Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097068Metagenome104N

Sequences

Protein IDFamilyRBSSequence
Ga0111544_10092205F097068N/AMVEDEVRRAHWKEHLIDENEELRNHVEAQHNFDNIPAERRIKTFEVKYDKDVVKAIYDRVKECREYYKTLIE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.