NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105745_1014486

Scaffold Ga0105745_1014486


Overview

Basic Information
Taxon OID3300007972 Open in IMG/M
Scaffold IDGa0105745_1014486 Open in IMG/M
Source Dataset NameCoastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1894
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location
Location NameOregon, USA
CoordinatesLat. (o)46.2357Long. (o)-123.9153Alt. (m)Depth (m)1.2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000808Metagenome / Metatranscriptome882Y
F014849Metagenome / Metatranscriptome259Y
F100416Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0105745_10144867F014849AGGMITNLDVLAIIIALLGCLTVMGLFWKQNITQQKEIRRLSVALRTERLKNK*
Ga0105745_10144868F100416AGAAGGMGKVKEALMDILEHDLCYGYGWIYQGNGIDFDSEACECNPYSISADELMDWKLN*
Ga0105745_10144869F000808GGAMEYTYSLTTSYDGELINTLRVSDMLEAVRAWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.