NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105745_1063468

Scaffold Ga0105745_1063468


Overview

Basic Information
Taxon OID3300007972 Open in IMG/M
Scaffold IDGa0105745_1063468 Open in IMG/M
Source Dataset NameCoastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1037
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location
Location NameOregon, USA
CoordinatesLat. (o)46.2357Long. (o)-123.9153Alt. (m)Depth (m)1.2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001538Metagenome / Metatranscriptome674Y
F002099Metagenome / Metatranscriptome593Y
F058793Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
Ga0105745_10634681F001538GGAGMIDTIKLFPTVQPSGYPDRHDLAQFKLEKQHEMNKANELAKQKQAQLQDLEFEIYTKKVVQERLRMEI
Ga0105745_10634682F002099N/AVRWLIALVLILSLYSTGQDLCSVREFYGIAYTVHNPSERHQQMSAWLTKHKSLCKSSDMTVIWNNLSEWAGSADSAELRHKVVQGYKDALKREKK*
Ga0105745_10634683F058793N/AMDETEARLNSHEQVCTLRYEMLCSRLKRLETVIMAASGVMLTGMSGIIFALMK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.