Basic Information | |
---|---|
Taxon OID | 3300007972 Open in IMG/M |
Scaffold ID | Ga0105745_1101656 Open in IMG/M |
Source Dataset Name | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 846 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Oregon, USA | |||||||
Coordinates | Lat. (o) | 46.2357 | Long. (o) | -123.9153 | Alt. (m) | Depth (m) | 1.2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028830 | Metagenome / Metatranscriptome | 190 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105745_11016561 | F028830 | N/A | MKLKIDRIDQHALTEFINRVKLIDSFIYMKIKEGQIHSTVYLPQRDAVKHHSIAADKIFQVSEWPDTDKEMKIAFFEGNKVIEAIKHFDHDAIKGELEFIENDEEFVASTLRIFNDELEITLSCSEPSLGFKDLSQDQRDAIFARSDSKFDFTLDTHSIGKVKNL |
⦗Top⦘ |