NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105746_1007779

Scaffold Ga0105746_1007779


Overview

Basic Information
Taxon OID3300007973 Open in IMG/M
Scaffold IDGa0105746_1007779 Open in IMG/M
Source Dataset NameCoastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3001
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location
Location NameOregon, USA
CoordinatesLat. (o)46.2357Long. (o)-123.9153Alt. (m)Depth (m)1.2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007260Metagenome / Metatranscriptome354N
F010835Metagenome / Metatranscriptome298N
F013879Metagenome / Metatranscriptome267N

Sequences

Protein IDFamilyRBSSequence
Ga0105746_10077794F010835AGGAMNAVALRTERALVDWLAAEDWSESPIGTPTCLTSYGHGAFADQDLEDQMPSFPRIVVRASTAVPVHPIERTCEVDITATLQLSADDTSEDHMLAIVQVFENLLQYLYVDGNIAELDALDTDPSGGFNAQFAVPVDFGINDISERARTFSRSMTIFAAANTI*
Ga0105746_10077795F013879N/AMTPTVTVDTSRFDAAWREYLPKTKRSLADAVNARTFFLMLRLYCLLPPKSPQAARNKILDYFNRPVGADRFDKKTGKRVGKSRQLRVVHLIAQAKNAKAGKPGLYGQDMRDAAGKLRRRAAGSVGYLKSCVTKAIKKLSPSFQQFGGTRRAKKGSAGVKSVAGNQALINLANQYGLPQENVAMHRGSSAYAFNAKAGFNPSSHVRMNIGLADNQVGTVEGIYAKAMQQAYNDEARELENHIAAALQAAFDGSESKGITVT*
Ga0105746_10077796F007260GAGMGNPSFLWQGVLVRCLPAAITDANSVISGGFQDNVQARVLVKFSDWRLADSTLVTVDAAVWSCDVGSNGDRLLQESGSLLLQENTDRLLLTFGKMIPVVGRLLTYDGRQMRIMSAKRDGSGAYYALELGSKTK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.