Scaffold Ga0102941_1283441

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102941_1283441

Scaffold Ga0102941_1283441

Overview

Basic Information
Taxon OID	3300007983 Open in IMG/M
Scaffold ID	Ga0102941_1283441 Open in IMG/M
Source Dataset Name	Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_C_D2_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	564
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location
Location Name	South San Francisco, USA
Coordinates	Lat. (^o)	37.4965	Long. (^o)	-122.133	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038111	Metagenome	166	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0102941_12834412	F038111	N/A	MIHRAPVVNRDDYTIWLENYRNIANFIHAEVYKYNKTTREEFGKDLDKLMDLHQNPLYVLTESDNKKLKKFMNIYGLTLDHKPLCDDGIEREVYRLDRRV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.