Scaffold Ga0108970_10996501

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0108970_10996501

Scaffold Ga0108970_10996501

Overview

Basic Information
Taxon OID	3300008055 Open in IMG/M
Scaffold ID	Ga0108970_10996501 Open in IMG/M
Source Dataset Name	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1034
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary → Microbial Communities Of Marine Eelgrass

Source Dataset Sampling Location
Location Name	Netarts Bay, Oregon, USA
Coordinates	Lat. (^o)	45.394187	Long. (^o)	-123.939629	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001106	Metagenome / Metatranscriptome	776	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0108970_109965011	F001106	N/A	MSFETLKVAELRKIAEDFAVDTDGIKSKADIVATLAEEGVTWSVYQKTIKDIEDATDEFNEDAEEIIPRFDPNAQPEDTVLVRMTRENFRYDIDGFTFTKEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.