NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0108970_11771499

Scaffold Ga0108970_11771499


Overview

Basic Information
Taxon OID3300008055 Open in IMG/M
Scaffold IDGa0108970_11771499 Open in IMG/M
Source Dataset NameMetatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15151
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (62.96%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary → Microbial Communities Of Marine Eelgrass

Source Dataset Sampling Location
Location NameNetarts Bay, Oregon, USA
CoordinatesLat. (o)45.394187Long. (o)-123.939629Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005300Metagenome / Metatranscriptome405Y
F012868Metagenome / Metatranscriptome276Y
F082120Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0108970_1177149910F012868GAGMKHYDYEWDLEPWGIKFDPELNIDKLGWQSGDCFKIKNVDGRAMLVKLDPLVKFIEEGLRNETSNLE*
Ga0108970_1177149915F082120N/AVFVEFELPQDESYGFVLNLIRLDIVDWATRYNIPYTQKTIKYTHRLAFDQDRFYTVFATTWNSKFEYRLIDRKW*
Ga0108970_1177149926F005300GAGMSKRIGPITLDGEAADRITVLTLKEQRNYLKKELTEWKKNPKTETNPDGYWLHPEDVSGNTIIVHHLDAVIRYFGG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.