Scaffold Ga0110929_1000204

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0110929_1000204

Scaffold Ga0110929_1000204

Overview

Basic Information
Taxon OID	3300008072 Open in IMG/M
Scaffold ID	Ga0110929_1000204 Open in IMG/M
Source Dataset Name	Microbial Communities in Water bodies, Singapore - Site MA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11235
Total Scaffold Genes	18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	14 (77.78%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies → Microbial Communities In Water Bodies, Singapore

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.3	Long. (^o)	103.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000324	Metagenome / Metatranscriptome	1299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0110929_10002046	F000324	N/A	MVSSVTLKHSLTYDGATLHVYHANKGEGLPKHEHEYSHATICHSGLCVVRVEGKELIMNKNTQPVNLLGGKWHEIEALEDGTVFVNVFAEGKY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.