Basic Information | |
---|---|
Taxon OID | 3300008221 Open in IMG/M |
Scaffold ID | Ga0114916_1005413 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5726 |
Total Scaffold Genes | 11 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (90.91%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | West Anvers Island | |||||||
Coordinates | Lat. (o) | -64.45 | Long. (o) | -64.88 | Alt. (m) | Depth (m) | 4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081540 | Metagenome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114916_10054131 | F081540 | AGGAG | MNKCNSATWLATGLFIGSLVGMGLLHIFETWQSNTTPSEVVCQKGRAFEQANYGASVYLKTDTECI |
⦗Top⦘ |