NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114916_1037899

Scaffold Ga0114916_1037899


Overview

Basic Information
Taxon OID3300008221 Open in IMG/M
Scaffold IDGa0114916_1037899 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1438
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameWest Anvers Island
CoordinatesLat. (o)-64.45Long. (o)-64.88Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028321Metagenome / Metatranscriptome192Y
F039830Metagenome / Metatranscriptome163Y
F066157Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0114916_10378993F066157AGAAGMWSIVLATMLASGQPQVPLIMSSYSTFDNCRLELLRVGKIGGYEAVVSPMVGYAVVKVGKDKTITVFCVKNMQSI*
Ga0114916_10378994F039830N/AMNSSPLEIYPVHVSPALAPIGQGLLIEPSVNRVNAEYLVVQPSREPYGVPQEYTRRVWIC
Ga0114916_10378995F028321AGGAGGMLAEIAIANAIWKTLSTALKNGKQLYEVGSQVNDYLSATQKVKEKAGDASSRGTALEAYQFEEQQRVQRSQLEFHLKKSRLGGWSDFVKCEAEWHRKRKEEEQEKRNARIRRNNKLQKDVALAINIGICLIIAMGLLFGIAIYLKGY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.