NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114841_1100337

Scaffold Ga0114841_1100337


Overview

Basic Information
Taxon OID3300008259 Open in IMG/M
Scaffold IDGa0114841_1100337 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1259
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.7026Long. (o)-83.2538Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041012Metagenome / Metatranscriptome160Y
F044900Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0114841_11003371F044900AGCAGGVHDPERPLTVPDGQESSPTWLEYVYRTAHPTLRWLPTKLAEWIGENLQDELGFPDKADKRAAAGSGWTPAELNHILQAHVVDGALTTFGCVEWESDLYRGTMRARCYPFDMPKRRFHSFNPKVCHSVLCTSYLHIPYSLWYILVYTKLNLVYTSIY*
Ga0114841_11003372F041012N/AMRPKNGRLPKDKRCHAGPDDIRYTLVFFSTFEELNLPMKGPMEDSGVVKLYEPSPTPCLYVGPAELMVGRVPLLPLYLAGNATPTIPHMFSKRKEAGFPFGCADAAALDGRRGSNIYEVNSWLWQFGRGKPRLGGLSVEQTGERKKVASDARHKRAAE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.