NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114336_1314390

Scaffold Ga0114336_1314390


Overview

Basic Information
Taxon OID3300008261 Open in IMG/M
Scaffold IDGa0114336_1314390 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)582
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.7026Long. (o)-83.236Alt. (m)Depth (m)5.7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032550Metagenome / Metatranscriptome179N

Sequences

Protein IDFamilyRBSSequence
Ga0114336_13143901F032550N/AIYPQCKDNKAPKNYFLGIFCGSRGSGKSYLFTKLLKTLEEKKVYLNDKVVPQRIILISSTAHSDSNKIFKTLKNLDWDHDVLEDYDDDLLKMKMDELKNDLDHSKDYKLYKQAWKNFIQCKDIEDLSDDEIKLLYSYDFIPFKEFPKPKYPDGFLIHWIIDDMLGTNIFKNGRSAFTNLCIRNRHLIPGNIII

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.