Scaffold Ga0114361_1085526

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114361_1085526

Scaffold Ga0114361_1085526

Overview

Basic Information
Taxon OID	3300008265 Open in IMG/M
Scaffold ID	Ga0114361_1085526 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	978
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location Name	Lake Erie, USA
Coordinates	Lat. (^o)	41.7026	Long. (^o)	-83.2538	Alt. (m)		Depth (m)	5.6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003109	Metagenome / Metatranscriptome	506	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114361_10855262	F003109	N/A	VHDPGTEFTGPEFQTLLENCLIKDVCTSAKNPQANVVCERMHQTVGNVLRTLLHSEPPQNINITTAKEFVDESLSIATHAMRAGIHTTLGSSPGSLVFNRDMFLNIPLIADWHAITLKRDHLIHENLLRENQKRRRYDCMPQQRVLKKCWKPRKLDERTSGPYRVVQTHVNGTVTIELRPGVS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.