NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115359_10162999

Scaffold Ga0115359_10162999


Overview

Basic Information
Taxon OID3300008340 Open in IMG/M
Scaffold IDGa0115359_10162999 Open in IMG/M
Source Dataset NameSea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)814
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)27.4Long. (o)-93.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061521Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0115359_101629992F061521GGAGGMKPALIRIEIERIVNLVAGFGWTKVEEKLAPGEVSITLKKVIPVTVEE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.