NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114880_1153688

Scaffold Ga0114880_1153688


Overview

Basic Information
Taxon OID3300008450 Open in IMG/M
Scaffold IDGa0114880_1153688 Open in IMG/M
Source Dataset NameFreshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)825
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Viral Communities During Cyanobacterial Harmful Algal Blooms (Chabs) In Western Lake Erie, Usa

Source Dataset Sampling Location
Location NameWestern Lake Erie
CoordinatesLat. (o)41.7032Long. (o)-83.2575Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003290Metagenome / Metatranscriptome495Y
F012655Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0114880_11536881F012655N/ADSTHRTQYLQANGYVDLDANHARAAGLRIETRVGDVRNSLTIKYGATSSSEQSADDLVSINQYGTLAQVITTTLHNAADATAQANFYLSLRAQPEPIFKEISFDLTNPEIDNSDRDNLINVFMGEAIALNNLPLNMSSGTFQGFVEGWSFQAAYNRLSVTLLLSPLAYSLQAMRWNDVPITETWSSVSPTLDWENATIVA*
Ga0114880_11536882F003290AGGAGMTNPTSNFNWQMPTSSDLVTDLPADFEVFGQAVDTSLADLKGGTTGQVLTKATNTDMDFTWSSVDPLVI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.