NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0110928_1012413

Scaffold Ga0110928_1012413


Overview

Basic Information
Taxon OID3300008510 Open in IMG/M
Scaffold IDGa0110928_1012413 Open in IMG/M
Source Dataset NameMicrobial Communities in Water bodies, Singapore - Site RA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1450
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies → Microbial Communities In Water Bodies, Singapore

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005388Metagenome / Metatranscriptome402N

Sequences

Protein IDFamilyRBSSequence
Ga0110928_10124132F005388N/AYPQGTGLTQTSFTTTSIEPTAAEEWSAITLASGNPGDNGGACDVTYNDVPVGYNAVTWGPERFALKGPLLCKDDLTFDHRVEAFLRVYLEKLSIRAQRCWETRYQNIFAKYAIKAVADSSFTQVETIPAGINELPWIQTGSVGQALNQATSELTQEMLDVAAATLIRNGATNPDSSGFISFSSDGPVFPLYIGLEASQRIAQNNAALREDLRFADMGSGPGAELLKRIGANRVIKNFRHIPNLFPPRFTYAGGKYTLVQPFTSSSGTKGTVFSVNPSWVSAQYEAAFVPTPYVIKSHIVRPVNRVGDLSWTPTNYMGEWQWVTGAYKLDVDCADPLEKKGQHYAEFVHAVEPIFTNQGMTIIFRRCTGALTTIICS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.