Scaffold Ga0111033_1009126

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0111033_1009126

Scaffold Ga0111033_1009126

Overview

Basic Information
Taxon OID	3300008516 Open in IMG/M
Scaffold ID	Ga0111033_1009126 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Aarhus University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4793
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location
Location Name	Aarhus Bay station M5
Coordinates	Lat. (^o)	56.10555	Long. (^o)	10.463333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038536	Metagenome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0111033_10091261	F038536	AGAAGG	MLDAVCTGLHPSAVISQLAEKYGVSEKALWSDWLRREKWVPFLLELEKFADFSGMVVERLNGVQKAAWSIYLKASNDSARVGALRTVLEALEIHRDIVQTMDVLDRLDQLEEVAKERCSEFKRGGGSLH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.