NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114021_103245

Scaffold Ga0114021_103245


Overview

Basic Information
Taxon OID3300008739 Open in IMG/M
Scaffold IDGa0114021_103245 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 1, subject 737052003 reassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7323
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 473(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077404Metagenome117N

Sequences

Protein IDFamilyRBSSequence
Ga0114021_1032454F077404N/AMNMLKTVFAFFFALCFMMGANSYAQKTDSINAEASERVLNRNAIYIPPALEQYADTTLLHQRFNVENKGNYLYTPFTEDNEPSILFNYGFLHPLGERFYNCFMGKVDRILRPKADKGFIIFTNYLVVLGDTYAFDTSNKDTSKLADLKYLDFRHIKRDFSYGHPYQGFTDYDRVELSNFVQSYGRQAALETANAWIMASYPFSLQSTKFENRYTRGRKLILTDGHSTLYLYFLMIDSVALNFDTEVLPYIKGVFRFNRFR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.