Scaffold Ga0103701_101281

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103701_101281

Scaffold Ga0103701_101281

Overview

Basic Information
Taxon OID	3300008795 Open in IMG/M
Scaffold ID	Ga0103701_101281 Open in IMG/M
Source Dataset Name	Microbial communities from freshwater in the western basin of Lake Erie, USA - 882-2
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Tennessee
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	809
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa

Source Dataset Sampling Location
Location Name	western basin of Lake Erie, USA
Coordinates	Lat. (^o)	41.76	Long. (^o)	-83.31	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018650	Metagenome / Metatranscriptome	234	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103701_1012811	F018650	N/A	MYVDFIEEELLPEINRLAEKYADWWTFKPSSPLKAYLSDREIVMDEYFSLEELRYRVMSILEHAAQFPNNSDVIVLEDQELQMVFDSWYIFVPDIIENHLLSHVIPAPADISNDLQNKHMIEDFFVYSPVDIIYKDPSSVFCPFVDFAMNRSTGNVGSWNKLLFMFTEFCLNNTTYFTRFSDCIIGINENTCLTSLFGFKYFHRSQIEHLLKKITKFLGRKNSMIQSCHFITHNPAFDITSIHPNVFTFIDDIINNNNDMMPDFQTGL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.