NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103483_1006245

Scaffold Ga0103483_1006245


Overview

Basic Information
Taxon OID3300008918 Open in IMG/M
Scaffold IDGa0103483_1006245 Open in IMG/M
Source Dataset NameMicrobial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KB2
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterSodertorn University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)548
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water → Microbial Communities Of Nutrient Treated Water From Blanes Bay, Barcelona, Spain

Source Dataset Sampling Location
Location NameBarcelona, Spain
CoordinatesLat. (o)41.666Long. (o)2.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007607Metagenome / Metatranscriptome348Y

Sequences

Protein IDFamilyRBSSequence
Ga0103483_10062451F007607N/AQLSACHSAAVDGVSCEIPNSQLFATGMNGDEDLGEDITMKGDKFHYVQKPAHAKLFATGMNGDEDLAEDITMKGDKFHYNQSLMQTGFATGMNGDEDLGQEITMKGQKFRYNQGQQQKLFAVGMNGDEDLGEDITMKGDKFHYVQRQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.