Basic Information | |
---|---|
Taxon OID | 3300008993 Open in IMG/M |
Scaffold ID | Ga0104258_1009573 Open in IMG/M |
Source Dataset Name | Marine microbial communities from eastern North Pacific Ocean - P1 free-living |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Georgia |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1779 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities From Seawater In Eastern North Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | eastern North Pacific Ocean | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016531 | Metagenome / Metatranscriptome | 246 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104258_10095733 | F016531 | N/A | MNRFSLILFMGTLLMLWGVSGVSKLSETAISSGFDGSVVSNVNAPGRLILVGFIGSRVASELIRRGERTVIIKDEDRSLANDKINDRKPGDVVN* |
⦗Top⦘ |