Scaffold Ga0102963_1003243

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102963_1003243

Scaffold Ga0102963_1003243

Overview

Basic Information
Taxon OID	3300009001 Open in IMG/M
Scaffold ID	Ga0102963_1003243 Open in IMG/M
Source Dataset Name	Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7200
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (53.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location
Location Name	South San Francisco, USA
Coordinates	Lat. (^o)	37.4973	Long. (^o)	-122.1295	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026890	Metagenome / Metatranscriptome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102963_100324313	F026890	AGGAG	MQYNIYQIKVTDEIHDFVNSNDRGHTGAAEKYPLYNAKMETMHARGDSDKIDFKPEYFSHYTKVCEVDGRCCGLSDGDRDYTVTSKNEVFSILNQCYLDEETGEDIVFDKHVSNYVTKTITRKNGEKVTYRDMHSLSVGDIIAEQPQVGYEVMDIDDIIPNTRYFIVEDYGFTDITEIIQDMDIAVNRIKEAV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.