NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105105_10013121

Scaffold Ga0105105_10013121


Overview

Basic Information
Taxon OID3300009009 Open in IMG/M
Scaffold IDGa0105105_10013121 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3365
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (11.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Namenear Jamestown, North Dakota
CoordinatesLat. (o)47.0991Long. (o)-99.1044Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015080Metagenome / Metatranscriptome257Y
F058096Metagenome / Metatranscriptome135Y
F082582Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0105105_100131211F015080N/AMFDQLQFEAHPIPGAIQARYKFSNEWSISVVSGLPGSGLYGNVTDNTYEVAIFRPNGNMTEDVIGWNTKAEVSAMMKVLVQL*
Ga0105105_100131213F058096N/AMNAQLSIDECKVMWVVGALERLATLGVIGPDIPLQLSADAVEDYIEIDNHRNLLFESDFEIASIFTQIAKAECEDEPTPDDIDAIIDLILQYKNNRTEIVKFALSHQTV*
Ga0105105_100131219F082582N/ANQTKMTVDFSKDVMLGMLRKGATGNQILDILDVIVPQDVVEMTREYVCDQLGIADCPENDDEIEAYLAAV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.