NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066710_100061689

Scaffold Ga0066710_100061689


Overview

Basic Information
Taxon OID3300009012 Open in IMG/M
Scaffold IDGa0066710_100061689 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4738
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029203Metagenome / Metatranscriptome189Y
F031038Metagenome / Metatranscriptome183Y

Sequences

Protein IDFamilyRBSSequence
Ga0066710_1000616891F031038GGCGGMKSTEEVLSDQQHFLSAVAPSGRSIEPCVFLVAQGIADQAVSYAEKFLGDSCVAVNLLEEAAATVSEVIRAKEAAQIAPIRDVRRYLFRVFLRKVAEARRNETTYEEVSQWHSHPCDDSHGDGLDSQLLLDQILGHFDSVTREMILRRIEGHSWGEIASEFELSNHAARVRFSKALQWLRTSVETSRNCRSKSTLPRSKKCHRPRDTKAQRVAAFERRLERMFTPAFYREFHQLLAATKTTGSL
Ga0066710_1000616895F029203AGGAGVLRDSEQPVVLKRRVRLEQDTSELLEDYARFIGISAEDVLNIVLKKMIGNDLEFQYWLSQQNVQQQRGQLPLGLSARVVETEAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.