NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115863_1035446

Scaffold Ga0115863_1035446


Overview

Basic Information
Taxon OID3300009034 Open in IMG/M
Scaffold IDGa0115863_1035446 Open in IMG/M
Source Dataset NameIntertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMacrogen
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6575
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal → Subsurface Anoxic Archaea In Intertidal Mud Flat Sediment

Source Dataset Sampling Location
Location NameGarolim Bay, Chungcheongnam-do, Korea
CoordinatesLat. (o)36.88Long. (o)126.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092306Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0115863_10354467F092306GGGGGMPAAFYSGPNWQQSSEPHTIVDVQESDCWPVDDRSISGAKDQLAAGLHPIIAIGGRTAADGRPLNLTGVVVSYYGTGAGTATDRVTVNIADGAIVRQYVANILTYAGGSAATFEQAPVVGQPVYVDDSADLAAGGTVSLSPLNSAGVRNPLAGYLWYCQDEIADGFAAGGRAAATFDVALSNSLVEQIYCVLLVNAARELA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.