NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099829_10145643

Scaffold Ga0099829_10145643


Overview

Basic Information
Taxon OID3300009038 Open in IMG/M
Scaffold IDGa0099829_10145643 Open in IMG/M
Source Dataset NameVadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1887
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California, Eel River Critical Zone Observatory
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003871Metagenome / Metatranscriptome464Y
F018134Metagenome236Y
F081532Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0099829_101456431F081532AGGMQWRPWRWCALALAVILLGCSSDNDPKPLTGTWTGTLQDSLAGRGTLVLNLSQTNRQLTGTWQSTFPDAQNNKGGMLSGTGPGQDLMITMVWSTAQPGACSFTVTAMLDINDE
Ga0099829_101456433F003871AGGAGMAWYQIIKAKSESYVADRDAEDLLRQFSAVLQAAEVPVAVEVFYGRTSHGARRYYFALSPEAVDLAERVLTSSDATLLAEPSDRTGMEKMRRV*
Ga0099829_101456435F018134GGAGMQKGHCTGHKKERKGSTVWYKPIAEENIRRSEAAWQAKQASK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.