NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114973_10030044

Scaffold Ga0114973_10030044


Overview

Basic Information
Taxon OID3300009068 Open in IMG/M
Scaffold IDGa0114973_10030044 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3297
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004132Metagenome / Metatranscriptome451Y
F019320Metagenome / Metatranscriptome230N
F084233Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0114973_100300441F019320GAGLHTLHWICIEAESPEQAAAQIKDNLSPNEYGYRMADWSDWHVVGGGRWNPDGDSYKDTVNMVVSYKDNPDKFKEVLSDIKKYRIEFMNKKLTVLDNAFDKLKSDIVDYISNDCKLNNDREFDFSRWEIKEAITMLSSEWTPESSFFDNQEFTSKLQYLEERLDKPEEAALHYLVPVDFHF
Ga0114973_100300444F084233N/AMTLTVEIYEMDYSCSPGGVNCWEVTTNHDLCISGFRTAGDALQWVLDKYPNHELNLNVKSLNWYFKEFADEYAV*
Ga0114973_100300447F004132AGGAMSEIMTQEQLTVSYNPNLLVTYKYVPETYAAPESPTFMTDKVTEIEWQLHKSREYAARSSALAAERRSDIEWLEEQIVEWYDPNYTKEEVLQALAEKFALNPTKEFEVQGTVSFSGTINVPLSEIADFDLSNVTIDVDLNSYEYDADLNVDEVSLEDHY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.