NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115566_10003822

Scaffold Ga0115566_10003822


Overview

Basic Information
Taxon OID3300009071 Open in IMG/M
Scaffold IDGa0115566_10003822 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_120405
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12082
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (52.17%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000379Metagenome / Metatranscriptome1211Y
F003326Metagenome / Metatranscriptome494Y
F065938Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0115566_1000382216F000379N/AMNKGVEMQKIDYTNKHDIMVGYIDRSQNICAVQTGWKTTPEEMAKILDRKYPTKEDSIKVVDSPVLIPTFRKEDYWGVEGFGDVIESNLSWHKEVMRKKVGHLFCHMTGVWKYSDNGIDWTPIREEFAEEFKEVA*
Ga0115566_1000382221F003326N/AMATIKQKKKLIRTIKNPIRYFRLNFSRYGGEVAMGTITKDQWEYWSDNDGFEEYMGQVDFDAEDANKEIPKRAQFDQPFYEYGDICHMSGPEWDDSQTMYIEEMDKDGKPLENEDGGYVQDIQHDFGDLESLGAEVVCDEEHNASSKSCENEYYVFGQYFNKGGWHTPDIIKTGPDGIELDKLKIRYTNADGFKVFNDIEYNGEAYYLEEDSTGKSSSFYVNRGDSIDG*
Ga0115566_1000382223F065938N/AMNKGVENMYKKDQHYNKKISTENLYKELDTHYNGETDLVRNLMSTAITEGLVETR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.