Basic Information | |
---|---|
Taxon OID | 3300009072 Open in IMG/M |
Scaffold ID | Ga0115030_1031855 Open in IMG/M |
Source Dataset Name | Marine algal microbial communities from Sidmouth, United Kingdom - Sidmouth_Male1 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1311 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sidmouth, United Kingdom | |||||||
Coordinates | Lat. (o) | 50.677 | Long. (o) | -3.24 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005043 | Metagenome | 413 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115030_10318551 | F005043 | GGAG | MCPYGLEIDISSSFFLHFWQGNSRNSQDLAWAAWSVPRKADQAATNSAFCWMQGSGTECGLSIGFDALLLLF* |
⦗Top⦘ |