Scaffold Ga0115030_1100055

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115030_1100055

Scaffold Ga0115030_1100055

Overview

Basic Information
Taxon OID	3300009072 Open in IMG/M
Scaffold ID	Ga0115030_1100055 Open in IMG/M
Source Dataset Name	Marine algal microbial communities from Sidmouth, United Kingdom - Sidmouth_Male1 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	548
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location Name	Sidmouth, United Kingdom
Coordinates	Lat. (^o)	50.677	Long. (^o)	-3.24	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080814	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115030_11000551	F080814	N/A	MQASRLDPPYEFEWTVFISWITVATAIAELETGRSASPVSRDPGSFRHFSHSQPLFFGVPPELPYLSSERLWLLEVHFRRSHIDF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.