NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115030_1111765

Scaffold Ga0115030_1111765


Overview

Basic Information
Taxon OID3300009072 Open in IMG/M
Scaffold IDGa0115030_1111765 Open in IMG/M
Source Dataset NameMarine algal microbial communities from Sidmouth, United Kingdom - Sidmouth_Male1 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)508
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location NameSidmouth, United Kingdom
CoordinatesLat. (o)50.677Long. (o)-3.24Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045508Metagenome152N

Sequences

Protein IDFamilyRBSSequence
Ga0115030_11117651F045508N/AQIVCCWLKADCLPAEAVARLRLQLGDIQVFAEPAHMDVSHFVAMMANTSLEHEFDGLSGQEQVLAVRRWLTAETDVEAIEQTVHMVLTGGDDEE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.