NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114957_1003565

Scaffold Ga0114957_1003565


Overview

Basic Information
Taxon OID3300009073 Open in IMG/M
Scaffold IDGa0114957_1003565 Open in IMG/M
Source Dataset NameMarine algal microbial communities from Bantry Bay, Ireland - BantryBay_4 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13933
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (68.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location NameBantry Bay, Ireland
CoordinatesLat. (o)51.64Long. (o)-9.71Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060562Metagenome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0114957_100356510F060562N/AMAYAKKLTTLLRIRHADNDRLVTKYAIHLYVDTGGARLFDRYFVFDNLSVPCIRGTEFIEQNIEAILPRLRKIVWQEHVRCTEELPRPKPILACINDSTHDRHWQDKFARVRAYKQIRVNGHQEECIMATCDTPGMVTVTPNARLCRNKSMAVARGLAIFKPDELFLVKMCHFGKDQVIVCKNSTLGFEEPYQGQMWSAVLDDKSPKDGADTTSAYASRDPLEDLDLSEASEYLH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.