Basic Information | |
---|---|
Taxon OID | 3300009073 Open in IMG/M |
Scaffold ID | Ga0114957_1038653 Open in IMG/M |
Source Dataset Name | Marine algal microbial communities from Bantry Bay, Ireland - BantryBay_4 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2308 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Dactylopodida → Paramoebidae → Paramoeba → Paramoeba aestuarina | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bantry Bay, Ireland | |||||||
Coordinates | Lat. (o) | 51.64 | Long. (o) | -9.71 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F102430 | Metagenome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114957_10386531 | F102430 | N/A | MDVSHVVAMMANTSLEHEFDGLSGQEQVLAVRRWLTAETDVEAIDHTVGTVLTVGDDEE* |
⦗Top⦘ |