Scaffold Ga0105099_10519367

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105099_10519367

Scaffold Ga0105099_10519367

Overview

Basic Information
Taxon OID	3300009082 Open in IMG/M
Scaffold ID	Ga0105099_10519367 Open in IMG/M
Source Dataset Name	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	723
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Name	near Jamestown, North Dakota
Coordinates	Lat. (^o)	47.0991	Long. (^o)	-99.1044	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075035	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105099_105193671	F075035	N/A	WNAKTLQGKDTTGFVRTGQVDAVTSAMIVPNTIVRADVATTFKAPYSDTADYAISAPASDSARVAGNSHLLQTKDTIALWNAKTLQGKDTTGFVRTGQPDAVTSAMIVPNTIVRADVATSFKAPYSDTADYAIAAPASDSARVAGNSHLLQGRDTTALWNAKTLQGKDTTGFVRTGQVDGVTSAMIVPNTIVRADVATNFKAPYADTADYAISAPASDSARVAGNSHLLQGKDTTALWNA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.