NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105240_10014216

Scaffold Ga0105240_10014216


Overview

Basic Information
Taxon OID3300009093 Open in IMG/M
Scaffold IDGa0105240_10014216 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10872
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (73.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001441Metagenome / Metatranscriptome694Y
F013397Metagenome / Metatranscriptome271Y
F099622Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0105240_1001421612F099622GGAGMVAKTISAMRALVADGVALSGLLDEVPDAEEIRTELDKPYFTRRWQHSMSRSFWITSDGMTAVCLTLTGLDLDETVALWVCFDEHRQRAAFNLSARTLREIIEAEIGLVVEIES*
Ga0105240_1001421614F013397GAGGMNNVARTLAVRTRLRQRALPHGALWRRLGEYAGGGVCAGCGERITSAQASYDVDFMPDVTPGTVRFHRECFEIWEHECQTPPAP*
Ga0105240_1001421615F001441GAGMNLNLIDAFGRFGATPSNRARSLSAIAADGAVVLNCSQQHFAHPFRGVLRYEDRLSREPQDSKDVALLGQHLTLARDGALPVRMIVAFSSDLKRGASRGYHIRPDLIGKVVKFDGDHF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.