NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079224_104320207

Scaffold Ga0079224_104320207


Overview

Basic Information
Taxon OID3300009095 Open in IMG/M
Scaffold IDGa0079224_104320207 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)558
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)41.7655Long. (o)-111.8143Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036417Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0079224_1043202072F036417N/AMVYYARAPLRQLIPTVLVRLATDDGEITFRARWRHSPLELQRMILFRLRRGRPLWFEDERGRDLCFKPEGVWAALVDGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.