NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0117938_110108

Scaffold Ga0117938_110108


Overview

Basic Information
Taxon OID3300009119 Open in IMG/M
Scaffold IDGa0117938_110108 Open in IMG/M
Source Dataset NameLake sediment microbial communities from Leach Lake, MN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Minnesota - Twin Cities
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)716
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities

Source Dataset Sampling Location
Location NameLeech Lake, MN
CoordinatesLat. (o)47.18868Long. (o)-94.626271Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071802Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0117938_1101081F071802AGGMGANTSKPNYASLISKILIVLVILNIAGDVLAAAFFLWDPSLGELSVYGGLIASFVGKSGAVMITSAILLGYAVVYAVSVFGLLSKLKWAPPLVIAVSVVNRALALGVIFEPNVAFLIWSAWKLVIIALAFYLWRKT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.