Scaffold Ga0117941_1057390

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117941_1057390

Scaffold Ga0117941_1057390

Overview

Basic Information
Taxon OID	3300009120 Open in IMG/M
Scaffold ID	Ga0117941_1057390 Open in IMG/M
Source Dataset Name	Lake sediment microbial communities from Tanners Lake, St. Paul, MN
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Minnesota - Twin Cities
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1043
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities

Source Dataset Sampling Location
Location Name	Tanners Lake, St. Paul, MN
Coordinates	Lat. (^o)	44.953471	Long. (^o)	-92.97875	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000982	Metagenome / Metatranscriptome	814	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117941_10573903	F000982	AGCAGG	MPTFKSTSRGRRLLEHHRIRGRAYPSMRYWERLHLMLLEEAEKRGKTPPPAPLVHGLEAEPTEADRMERLDEQVAWADRNQLLHRVQM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.