Scaffold Ga0118727_1041998

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118727_1041998

Scaffold Ga0118727_1041998

Overview

Basic Information
Taxon OID	3300009128 Open in IMG/M
Scaffold ID	Ga0118727_1041998 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0137084, Gp0137083
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Genomics Facility
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5015
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (22.22%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location Name	Cariaco Basin, Venezuela
Coordinates	Lat. (^o)	10.5	Long. (^o)	-64.66	Alt. (m)		Depth (m)	234
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060045	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118727_10419982	F060045	GAG	MIFNYSKPIRVQASVSMWKNQVFVFVNVIWVVPLVVLAARKTIMMHTDVSAVKCILSR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.