Scaffold Ga0118728_1089809

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118728_1089809

Scaffold Ga0118728_1089809

Overview

Basic Information
Taxon OID	3300009129 Open in IMG/M
Scaffold ID	Ga0118728_1089809 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0139513, Gp0139514
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Genomics Facility
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1427
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location Name	Cariaco Basin, Venezuela
Coordinates	Lat. (^o)	10.5	Long. (^o)	-64.66	Alt. (m)		Depth (m)	198
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078608	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118728_10898092	F078608	N/A	MYIRKVDIKLTEKDIGRMVQTVAKETHSLDKSMQIAALFSELLLNSTEGSTMFVLIMLGNGLPEVAREGDVVRCNWERLKIGLTDPDDIYEKLKESNLINSRNEVTCKIQSFKGYTAYFPYTIEFKYGEDLYATASMAFEDVSW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.