NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114962_10013434

Scaffold Ga0114962_10013434


Overview

Basic Information
Taxon OID3300009151 Open in IMG/M
Scaffold IDGa0114962_10013434 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5957
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (78.95%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040597Metagenome / Metatranscriptome161Y
F087184Metagenome / Metatranscriptome110N
F091943Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0114962_1001343415F091943AGGAMQKKWCLLKSSDGQRGANGKRKIYEVTVDGPVVRTSWGMAEKPVRQNEIKNYRDEFYARQMAFMKVQEKLNKGYELAYAV*
Ga0114962_1001343418F087184AGGAMNIEDLVSQIESGTFDSGLVKIKDAVDSRLKASRVSRTIADYHIGDTVVFNDLTGTRYMVGRKATVTGMKQKKVVVRLETPVGRFEKINPITGKSESADIVVPVAIIDLVK*
Ga0114962_100134345F040597GAGMSKNASAGIWEIRDVHTGERISKFRARKRADVDRMLQMASVGLKRPLADFEAVYLTDWE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.