NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114968_10017280

Scaffold Ga0114968_10017280


Overview

Basic Information
Taxon OID3300009155 Open in IMG/M
Scaffold IDGa0114968_10017280 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5021
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (43.75%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034177Metagenome / Metatranscriptome175Y
F039511Metagenome / Metatranscriptome163Y
F043386Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
Ga0114968_100172801F034177N/AIDAIEARLEFLKTDTTKWVSAFAQPDGCTPYNHGNYFRKLERNRLKTKLKRLQKKLAKN*
Ga0114968_1001728012F039511N/AMKRELKALEAKIKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK*
Ga0114968_100172804F043386GAGMTHKEFKLTVKNEILEDAGYERKAVHYRIGDVVTVDEVTFDTLQAGSIIQRYTQEGWFTFDKYDFENEVAVTTITVDYSIRKLGQKKQK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.